Lineage for d1u12b_ (1u12 B:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Putative ion channel CnbD [110321] (1 species) Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries)
Uniprot Q98GN8 218-350 # mll3241
Domain d1u12b_: 1u12 B: [112947]
complexed with iod, k, so4; mutant
Details for d1u12b_
PDB Entry: 1u12 (more details), 2.7 Å
PDB Description: m. loti cyclic nucleotide binding domain mutant
PDB Compounds: (B:) cyclic nucleotide binding domainSCOPe Domain Sequences for d1u12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u12b_ b.82.3.2 (B:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv
svatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeiaei
frktale
SCOPe Domain Coordinates for d1u12b_:
Click to download the PDB-style file with coordinates for d1u12b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u12b_:
- d1u12b_ first appeared in SCOP 1.71
- d1u12b_ appears in SCOPe 2.05
- d1u12b_ appears in SCOPe 2.07
- d1u12b_ appears in the current release, SCOPe 2.08
View in 3D
