![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Putative ion channel CnbD [110321] (1 species) |
![]() | Species Mesorhizobium loti [TaxId:381] [110322] (2 PDB entries) Uniprot Q98GN8 218-350 # mll3241 |
![]() | Domain d1u12b_: 1u12 B: [112947] complexed with iod, k, so4; mutant |
PDB Entry: 1u12 (more details), 2.7 Å
SCOPe Domain Sequences for d1u12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u12b_ b.82.3.2 (B:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv svatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeiaei frktale
Timeline for d1u12b_: