Lineage for d1u08a_ (1u08 A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) 
Protein Putative methionine aminotransferase YdbL [110679] (1 species) Species Escherichia coli [TaxId:562] [110680] (1 PDB entry)
Uniprot P77806
Domain d1u08a_: 1u08 A: [107543]
complexed with plp
Details for d1u08a_
PDB Entry: 1u08 (more details), 2.35 Å
PDB Description: Crystal Structure and Reactivity of YbdL from Escherichia coli Identify a Methionine Aminotransferase Function.
PDB Compounds: (A:) Hypothetical aminotransferase ybdLSCOPe Domain Sequences for d1u08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]}
plipqsklpqlgttiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqganqya
pmtgvqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevicfdps
ydsyapaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvwqqad
faalwqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhmtgwk
vgycvapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrdilvn
alnesrleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpfphkl
irlcfakkestllaaaerlrql
SCOPe Domain Coordinates for d1u08a_:
Click to download the PDB-style file with coordinates for d1u08a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u08a_:
- d1u08a_ first appeared in SCOP 1.69
- d1u08a_ appears in SCOPe 2.03
- d1u08a_ appears in SCOPe 2.05
- d1u08a_ appears in the current release, SCOPe 2.08
View in 3D
