Lineage for d1tzza2 (1tzz A:1006-1145)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554628Protein Hypothetical protein Bll6730 [117927] (1 species)
  7. 2554629Species Bradyrhizobium japonicum [TaxId:375] [117928] (1 PDB entry)
    Uniprot Q89FH0
  8. 2554630Domain d1tzza2: 1tzz A:1006-1145 [112897]
    Other proteins in same PDB: d1tzza1, d1tzzb1
    Structural genomics target
    complexed with mg

Details for d1tzza2

PDB Entry: 1tzz (more details), 1.86 Å

PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum
PDB Compounds: (A:) Hypothetical protein L1841

SCOPe Domain Sequences for d1tzza2:

Sequence, based on SEQRES records: (download)

>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
vrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqgg
lirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwd
avakiagkplfrllaerhgv

Sequence, based on observed residues (ATOM records): (download)

>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
vrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfasr
ileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagkp
lfrllaerhgv

SCOPe Domain Coordinates for d1tzza2:

Click to download the PDB-style file with coordinates for d1tzza2.
(The format of our PDB-style files is described here.)

Timeline for d1tzza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tzza1