Lineage for d1tzyc_ (1tzy C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311738Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (6 PDB entries)
    Uniprot P84229
  8. 2311739Domain d1tzyc_: 1tzy C: [107532]
    Other proteins in same PDB: d1tzya_, d1tzyb_, d1tzyd_, d1tzye_, d1tzyf_, d1tzyh_
    complexed with cl, po4

Details for d1tzyc_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (C:) histone h3

SCOPe Domain Sequences for d1tzyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
vglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1tzyc_:

Click to download the PDB-style file with coordinates for d1tzyc_.
(The format of our PDB-style files is described here.)

Timeline for d1tzyc_: