Lineage for d1tzya_ (1tzy A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764838Protein Histone H2A [47115] (6 species)
  7. 764892Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 764893Domain d1tzya_: 1tzy A: [107530]
    Other proteins in same PDB: d1tzyb_, d1tzyc_, d1tzyd_, d1tzyf_, d1tzyg_, d1tzyh_

Details for d1tzya_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (A:) histone h2a-IV

SCOP Domain Sequences for d1tzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk

SCOP Domain Coordinates for d1tzya_:

Click to download the PDB-style file with coordinates for d1tzya_.
(The format of our PDB-style files is described here.)

Timeline for d1tzya_: