SCOP 1.73: Domain d1tyqa1: 1tyq A:2-160

Lineage for d1tyqa1 (1tyq A:2-160)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
duplication contains two domains of this fold
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
Protein Actin-related protein 3, Arp3 [69528] (1 species)
part of Arp2/3 complex
Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
Domain d1tyqa1: 1tyq A:2-160 [112841]
Other proteins in same PDB: d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_

Details for d1tyqa1

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium

PDB Compounds: (A:) Actin-related protein 3

SCOP Domain Sequences for d1tyqa1:

Sequence, based on SEQRES records: (download)

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrqvge

SCOP Domain Coordinates for d1tyqa1:

Click to download the PDB-style file with coordinates for d1tyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tyqa1: