Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.31: ThiG-like [110399] (2 families) shares the common phosphate-binding site with other superfamilies |
Family c.1.31.1: ThiG-like [110400] (1 protein) Pfam PF05690 |
Protein Thiazole biosynthesis protein ThiG [110401] (2 species) |
Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries) Uniprot O31618 |
Domain d1tyga_: 1tyg A: [107454] Other proteins in same PDB: d1tygb_, d1tygg_ complexed with po4 |
PDB Entry: 1tyg (more details), 3.15 Å
SCOPe Domain Sequences for d1tyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyga_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk qy
Timeline for d1tyga_: