Lineage for d1ty9b_ (1ty9 B:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-keySuperfamily b.45.1: FMN-binding split barrel [50475] (5 families) 
related to the ferredoxin reductase-like FAD-binding domain
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) 
Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
elaborated with additional secondary structures; active as dimerSpecies Pseudomonas fluorescens [TaxId:294] [117227] (5 PDB entries)
Uniprot Q51793
Domain d1ty9b_: 1ty9 B: [112828]
complexed with fmn, so4
Details for d1ty9b_
PDB Entry: 1ty9 (more details), 1.8 Å
PDB Description: x-ray crystal structure of phzg from pseudomonas fluorescens
PDB Compounds: (B:) Phenazine biosynthesis protein phzGSCOPe Domain Sequences for d1ty9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty9b_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]}
sesltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstriv
viseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakadda
wlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefw
gngqerlherlrydrsdtgwnvrrlqp
SCOPe Domain Coordinates for d1ty9b_:
Click to download the PDB-style file with coordinates for d1ty9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ty9b_:
- d1ty9b_ first appeared in SCOP 1.71
- d1ty9b_ appears in SCOPe 2.05
- d1ty9b_ appears in SCOPe 2.07
- d1ty9b_ appears in the current release, SCOPe 2.08
View in 3D
