Lineage for d1txua_ (1txu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737770Fold a.222: VPS9 domain [109992] (1 superfamily)
    multihelical; consist of two subdomains
  4. 2737771Superfamily a.222.1: VPS9 domain [109993] (1 family) (S)
  5. 2737772Family a.222.1.1: VPS9 domain [109994] (2 proteins)
    Pfam PF02204
  6. 2737773Protein Rab5 GDP/GTP exchange factor (Rabex-5) [109995] (1 species)
  7. 2737774Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109996] (1 PDB entry)
    Uniprot Q9UJ41
  8. 2737775Domain d1txua_: 1txu A: [107439]
    complexed with mg

Details for d1txua_

PDB Entry: 1txu (more details), 2.35 Å

PDB Description: crystal structure of the vps9 domain of rabex-5
PDB Compounds: (A:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d1txua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txua_ a.222.1.1 (A:) Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
etdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaerm
qtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqml
cvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasad
dflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqs
lnlsqedfdrymsg

SCOPe Domain Coordinates for d1txua_:

Click to download the PDB-style file with coordinates for d1txua_.
(The format of our PDB-style files is described here.)

Timeline for d1txua_: