Lineage for d1txba_ (1txb A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702329Protein Toxin B (long neurotoxin) [57349] (1 species)
  7. 1702330Species King cobra (Ophiophagus hannah) [TaxId:8665] [57350] (2 PDB entries)
  8. 1702331Domain d1txba_: 1txb A: [44455]

Details for d1txba_

PDB Entry: 1txb (more details)

PDB Description: solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, 10 structures
PDB Compounds: (A:) toxin b

SCOPe Domain Sequences for d1txba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txba_ g.7.1.1 (A:) Toxin B (long neurotoxin) {King cobra (Ophiophagus hannah) [TaxId: 8665]}
tkcyvtpdatsqtcpdgqdicytktwcdgfcssrgkridlgcaatcpkvkpgvdikccst
dncnpfptwkrkh

SCOPe Domain Coordinates for d1txba_:

Click to download the PDB-style file with coordinates for d1txba_.
(The format of our PDB-style files is described here.)

Timeline for d1txba_: