Lineage for d1twfi1 (1twf I:1-49)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705857Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1705858Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)
  6. 1705859Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1705860Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1705861Domain d1twfi1: 1twf I:1-49 [112733]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfj_, d1twfk_, d1twfl_
    protein/RNA complex; complexed with mn, utp, zn

Details for d1twfi1

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution
PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOPe Domain Sequences for d1twfi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfi1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d1twfi1:

Click to download the PDB-style file with coordinates for d1twfi1.
(The format of our PDB-style files is described here.)

Timeline for d1twfi1: