| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
| Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries) Uniprot Q7A3F6 |
| Domain d1tvza1: 1tvz A:2-167 [107367] Other proteins in same PDB: d1tvza2 complexed with so4 |
PDB Entry: 1tvz (more details), 2 Å
SCOPe Domain Sequences for d1tvza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvza1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps
Timeline for d1tvza1: