Lineage for d1tvkb1 (1tvk B:2-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863279Protein Tubulin beta-subunit [52496] (2 species)
  7. 2863280Species Cow (Bos taurus) [TaxId:9913] [63990] (6 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 2863284Domain d1tvkb1: 1tvk B:2-245 [107364]
    Other proteins in same PDB: d1tvka2, d1tvkb2
    complexed with ep, gdp, gtp

Details for d1tvkb1

PDB Entry: 1tvk (more details), 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1tvkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvkb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgq

SCOPe Domain Coordinates for d1tvkb1:

Click to download the PDB-style file with coordinates for d1tvkb1.
(The format of our PDB-style files is described here.)

Timeline for d1tvkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvkb2