Lineage for d1tvkb1 (1tvk B:2-245)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein Tubulin beta-subunit [52496] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [63990] (6 PDB entries)
Uniprot P02550 ! Uniprot P02554
Domain d1tvkb1: 1tvk B:2-245 [107364]
Other proteins in same PDB: d1tvka2, d1tvkb2
complexed with ep, gdp, gtp
Details for d1tvkb1
PDB Entry: 1tvk (more details), 2.89 Å
PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography
PDB Compounds: (B:) Tubulin beta chainSCOPe Domain Sequences for d1tvkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvkb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgq
SCOPe Domain Coordinates for d1tvkb1:
Click to download the PDB-style file with coordinates for d1tvkb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tvkb1:
- d1tvkb1 first appeared in SCOP 1.69
- d1tvkb1 appears in SCOPe 2.07
View in 3D
