Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries) Uniprot Q53613 21-383 |
Domain d1tvfa2: 1tvf A:21-315 [107359] Other proteins in same PDB: d1tvfa1, d1tvfa3, d1tvfb1, d1tvfb3 Structural genomics target complexed with so4, unl |
PDB Entry: 1tvf (more details), 2 Å
SCOPe Domain Sequences for d1tvfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvfa2 e.3.1.1 (A:21-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} yaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklm tmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnss naaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqer tvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglkt gssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy
Timeline for d1tvfa2: