Lineage for d1tuya1 (1tuy A:1-197)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.2: Acetokinase-like [53080] (4 proteins) 
Protein Acetate kinase [53081] (1 species) Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)
Uniprot P38502 1-399
Domain d1tuya1: 1tuy A:1-197 [112666]
complexed with acy, adp, af3, so4
Details for d1tuya1
PDB Entry: 1tuy (more details), 3 Å
PDB Description: Acetate Kinase complexed with ADP, AlF3 and acetate
PDB Compounds: (A:) acetate kinaseSCOPe Domain Sequences for d1tuya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuya1 c.55.1.2 (A:1-197) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk
SCOPe Domain Coordinates for d1tuya1:
Click to download the PDB-style file with coordinates for d1tuya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tuya1:
- d1tuya1 first appeared in SCOP 1.71
- d1tuya1 appears in SCOPe 2.07
View in 3D
