Lineage for d1tuba2 (1tub A:246-440)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727435Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 727436Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 727469Protein Tubulin alpha-subunit [55311] (2 species)
  7. 727477Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries)
  8. 727478Domain d1tuba2: 1tub A:246-440 [39803]
    Other proteins in same PDB: d1tuba1, d1tubb1, d1tubb2
    complexed with gdp, gtp, txl

Details for d1tuba2

PDB Entry: 1tub (more details), 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction
PDB Compounds: (A:) tubulin

SCOP Domain Sequences for d1tuba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOP Domain Coordinates for d1tuba2:

Click to download the PDB-style file with coordinates for d1tuba2.
(The format of our PDB-style files is described here.)

Timeline for d1tuba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tuba1