Lineage for d1tu7a1 (1tu7 A:78-208)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735942Protein Class pi GST [81347] (4 species)
  7. 1736088Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries)
    Uniprot P46427
  8. 1736089Domain d1tu7a1: 1tu7 A:78-208 [112653]
    Other proteins in same PDB: d1tu7a2, d1tu7b2
    complexed with gol, gsh

Details for d1tu7a1

PDB Entry: 1tu7 (more details), 1.5 Å

PDB Description: structure of onchocerca volvulus pi-class glutathione s-transferase
PDB Compounds: (A:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn
grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda
akvpvngngkq

SCOPe Domain Coordinates for d1tu7a1:

Click to download the PDB-style file with coordinates for d1tu7a1.
(The format of our PDB-style files is described here.)

Timeline for d1tu7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu7a2