Lineage for d1tu6a_ (1tu6 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein (Pro)cathepsin K [54028] (3 species) Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
Uniprot P43235 116-329 ! Uniprot P43235 115-329
Domain d1tu6a_: 1tu6 A: [107318]
complexed with fsp, so4
Details for d1tu6a_
PDB Entry: 1tu6 (more details), 1.75 Å
PDB Description: Cathepsin K complexed with a ketoamide inhibitor
PDB Compounds: (A:) cathepsin kSCOPe Domain Sequences for d1tu6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu6a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm
SCOPe Domain Coordinates for d1tu6a_:
Click to download the PDB-style file with coordinates for d1tu6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tu6a_:
- d1tu6a_ first appeared in SCOP 1.69
- d1tu6a_ appears in SCOPe 2.07
View in 3D
