Lineage for d1tu4a_ (1tu4 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363414Protein Rab5a [82399] (1 species)
  7. 1363415Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 1363427Domain d1tu4a_: 1tu4 A: [112649]
    complexed with co, gdp, so4

Details for d1tu4a_

PDB Entry: 1tu4 (more details), 2.2 Å

PDB Description: Crystal Structure of Rab5-GDP Complex
PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1tu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu4a_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk

SCOPe Domain Coordinates for d1tu4a_:

Click to download the PDB-style file with coordinates for d1tu4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tu4a_: