![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
![]() | Species Thermotoga maritima [TaxId:2336] [116817] (2 PDB entries) Uniprot P77994 313-399 |
![]() | Domain d1ttya_: 1tty A: [112638] |
PDB Entry: 1tty (more details)
SCOPe Domain Sequences for d1ttya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} keamrmlmreelekvlktlspreamvlrmryglldgkpktleevgqyfnvtrerirqiev kalrklrhpsrskylksllslmdeneg
Timeline for d1ttya_: