| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
| Protein MDM2 [47594] (2 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (12 PDB entries) Uniprot P56273 13-119 |
| Domain d1ttva_: 1ttv A: [112637] complexed with imy |
PDB Entry: 1ttv (more details)
SCOPe Domain Sequences for d1ttva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttva_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
nhistsdqeklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivh
csndplgelfgvqefsvkehrriyamisrnlvsanvkessedifgnv
Timeline for d1ttva_: