Lineage for d1trna_ (1trn A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) Protein Trypsin(ogen) [50515] (9 species) 
Species Human (Homo sapiens) [TaxId:9606] [50519] (4 PDB entries) 
Domain d1trna_: 1trn A: [26000]
complexed with isp
Details for d1trna_
PDB Entry: 1trn (more details), 2.2 Å
PDB Description: crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
PDB Compounds: (A:) TrypsinSCOPe Domain Sequences for d1trna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trna_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinarvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdsggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans
SCOPe Domain Coordinates for d1trna_:
Click to download the PDB-style file with coordinates for d1trna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trna_:
- d1trna_ first appeared (with stable ids) in SCOP 1.55
- d1trna_ appears in SCOPe 2.05
- d1trna_ appears in SCOPe 2.07
- d1trna_ appears in the current release, SCOPe 2.08
View in 3D
