| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein) |
| Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries) Uniprot O30245 # AF2426 |
| Domain d1tqia1: 1tqi A:1-90 [107226] Other proteins in same PDB: d1tqia2 complexed with edo |
PDB Entry: 1tqi (more details), 2 Å
SCOPe Domain Sequences for d1tqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqia1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk
Timeline for d1tqia1: