Lineage for d1tqia1 (1tqi A:1-90)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) 
contains a small beta-sheet (wing)
Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein) Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species) Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries) 
Domain d1tqia1: 1tqi A:1-90 [107226]
Other proteins in same PDB: d1tqia2
complexed with edo
Details for d1tqia1
PDB Entry: 1tqi (more details), 2 Å
PDB Description: Crystal Structure of A. Fulgidus Rio2 Serine Protein Kinase
PDB Compounds: (A:) conserved hypothetical proteinSCOP Domain Sequences for d1tqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqia1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk
SCOP Domain Coordinates for d1tqia1:
Click to download the PDB-style file with coordinates for d1tqia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tqia1:
- d1tqia1 first appeared in SCOP 1.69
- d1tqia1 appears in SCOP 1.71
- d1tqia1 appears in SCOP 1.75
- d1tqia1 appears in the current release, SCOPe 2.08
View in 3D
