Lineage for d1tqia1 (1tqi A:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694282Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)
    automatically mapped to Pfam PF09202
  6. 2694283Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)
  7. 2694284Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries)
    Uniprot O30245 # AF2426
  8. 2694285Domain d1tqia1: 1tqi A:1-90 [107226]
    Other proteins in same PDB: d1tqia2
    complexed with edo

Details for d1tqia1

PDB Entry: 1tqi (more details), 2 Å

PDB Description: Crystal Structure of A. Fulgidus Rio2 Serine Protein Kinase
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1tqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqia1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk

SCOPe Domain Coordinates for d1tqia1:

Click to download the PDB-style file with coordinates for d1tqia1.
(The format of our PDB-style files is described here.)

Timeline for d1tqia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqia2