| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Domain d1toza2: 1toz A:453-491 [112606] |
PDB Entry: 1toz (more details)
SCOPe Domain Sequences for d1toza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1toza2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}
vnecvsnpcqndatcldqigefqcicmpgyegvhcevnt
Timeline for d1toza2: