Lineage for d1toua_ (1tou A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804864Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
    Uniprot P15090
  8. 2804887Domain d1toua_: 1tou A: [107178]
    complexed with b1v

Details for d1toua_

PDB Entry: 1tou (more details), 2 Å

PDB Description: Crystal structure of human adipocyte fatty acid binding protein in complex with a non-covalent ligand
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d1toua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toua_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d1toua_:

Click to download the PDB-style file with coordinates for d1toua_.
(The format of our PDB-style files is described here.)

Timeline for d1toua_: