Class g: Small proteins [56992] (98 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.6: ZZ domain [161211] (4 proteins) Pfam PF00569 |
Protein CREB-binding protein, CBP [161212] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [161213] (1 PDB entry) Uniprot P45481 1700-1751 |
Domain d1tota1: 1tot A:1-52 [145777] complexed with zn |
PDB Entry: 1tot (more details)
SCOPe Domain Sequences for d1tota1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} gqdrfvytcneckhhvetrwhctvcedydlcincyntkshthkmvkwglgld
Timeline for d1tota1: