Lineage for d1tola2 (1tol A:125-216)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446121Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 1446122Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 1446123Family d.212.1.1: TolA [55217] (1 protein)
    contains extra N-terminal helix
  6. 1446124Protein TolA [55218] (2 species)
  7. 1446125Species Escherichia coli [TaxId:562] [55219] (2 PDB entries)
  8. 1446126Domain d1tola2: 1tol A:125-216 [39587]
    Other proteins in same PDB: d1tola1
    Fused with the N-terminal domain of gp3 from phage M13

Details for d1tola2

PDB Entry: 1tol (more details), 1.85 Å

PDB Description: fusion of n-terminal domain of the minor coat protein from gene iii in phage m13, and c-terminal domain of e. coli protein-tola
PDB Compounds: (A:) protein (fusion protein consisting of minor coat protein, glycine rich linker, tola, and a his tag)

SCOPe Domain Sequences for d1tola2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tola2 d.212.1.1 (A:125-216) TolA {Escherichia coli [TaxId: 562]}
sgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpeggdpalcqaal
aaaklakipkppsqavyevfknapldfkpaaa

SCOPe Domain Coordinates for d1tola2:

Click to download the PDB-style file with coordinates for d1tola2.
(The format of our PDB-style files is described here.)

Timeline for d1tola2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tola1