Lineage for d1tn6b_ (1tn6 B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
Uniprot P49356
Domain d1tn6b_: 1tn6 B: [112528]
Other proteins in same PDB: d1tn6a_
complexed with acy, fii, suc, zn
Details for d1tn6b_
PDB Entry: 1tn6 (more details), 1.8 Å
PDB Description: protein farnesyltransferase complexed with a rap2a peptide substrate and a fpp analog at 1.8a resolution
PDB Compounds: (B:) Protein farnesyltransferase beta subunitSCOPe Domain Sequences for d1tn6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tn6b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
SCOPe Domain Coordinates for d1tn6b_:
Click to download the PDB-style file with coordinates for d1tn6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tn6b_:
- d1tn6b_ first appeared in SCOP 1.71
- d1tn6b_ appears in SCOPe 2.05
- d1tn6b_ appears in SCOPe 2.07
- d1tn6b_ appears in the current release, SCOPe 2.08
View in 3D
