Lineage for d1tmqb_ (1tmq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328002Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2328003Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2328065Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 2328076Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species)
  7. 2328077Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries)
  8. 2328078Domain d1tmqb_: 1tmq B: [17824]
    Other proteins in same PDB: d1tmqa1, d1tmqa2
    complexed with ca, cl

Details for d1tmqb_

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
PDB Compounds: (B:) protein (ragi bifunctional inhibitor)

SCOPe Domain Sequences for d1tmqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqb_ a.52.1.2 (B:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]}
svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsl

SCOPe Domain Coordinates for d1tmqb_:

Click to download the PDB-style file with coordinates for d1tmqb_.
(The format of our PDB-style files is described here.)

Timeline for d1tmqb_: