Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) |
Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 proteins) Pfam 01341 |
Protein Cellulase E2 [51991] (1 species) |
Species Thermomonospora fusca, strain yx [TaxId:269800] [51992] (1 PDB entry) |
Domain d1tml__: 1tml - [30656] complexed with so4 |
PDB Entry: 1tml (more details), 1.8 Å
SCOP Domain Sequences for d1tml__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tml__ c.6.1.1 (-) Cellulase E2 {Thermomonospora fusca, strain yx} ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa
Timeline for d1tml__: