Lineage for d1tlua_ (1tlu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602871Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
    duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687
  4. 2602872Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families) (S)
  5. 2602890Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins)
    Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme
  6. 2602891Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)
  7. 2602892Species Thermotoga maritima [TaxId:2336] [111224] (2 PDB entries)
    Uniprot Q9WZC3
  8. 2602893Domain d1tlua_: 1tlu A: [107139]

Details for d1tlua_

PDB Entry: 1tlu (more details), 1.55 Å

PDB Description: Crystal Structure of Thermotoga maritima S-adenosylmethionine decarboxylase
PDB Compounds: (A:) S-adenosylmethionine decarboxylase proenzyme, AdoMetDC, SamDC

SCOPe Domain Sequences for d1tlua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlua_ d.156.1.2 (A:) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

SCOPe Domain Coordinates for d1tlua_:

Click to download the PDB-style file with coordinates for d1tlua_.
(The format of our PDB-style files is described here.)

Timeline for d1tlua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tlub_