Lineage for d1tlma_ (1tlm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1772956Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1772957Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1772978Species Human (Homo sapiens) [TaxId:9606] [49475] (234 PDB entries)
    Uniprot P02766 31-143
  8. 1773235Domain d1tlma_: 1tlm A: [22559]
    complexed with mil

Details for d1tlma_

PDB Entry: 1tlm (more details), 1.9 Å

PDB Description: structural aspects of inotropic bipyridine binding: crystal structure determination to 1.9 angstroms of the human serum transthyretin- milrinone complex
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1tlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlma_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
tgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqf
vegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
pke

SCOPe Domain Coordinates for d1tlma_:

Click to download the PDB-style file with coordinates for d1tlma_.
(The format of our PDB-style files is described here.)

Timeline for d1tlma_: