Lineage for d1tksa_ (1tks A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.115: YrdC/RibB [55820] (1 superfamily)
core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each otherSuperfamily d.115.1: YrdC/RibB [55821] (3 families) 
Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
contains one additional helix in the C-terminal extension
automatically mapped to Pfam PF00926Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species) 
Species Yeast (Candida albicans) [TaxId:5476] [111135] (2 PDB entries)
Uniprot Q5A3V6
Domain d1tksa_: 1tks A: [107114]
Details for d1tksa_
PDB Entry: 1tks (more details), 1.6 Å
PDB Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthaseSCOPe Domain Sequences for d1tksa_:
Sequence, based on SEQRES records: (download)
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyisk
Sequence, based on observed residues (ATOM records): (download)
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyisk
SCOPe Domain Coordinates for d1tksa_:
Click to download the PDB-style file with coordinates for d1tksa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tksa_:
- d1tksa_ first appeared in SCOP 1.69
- d1tksa_ appears in SCOPe 2.05
- d1tksa_ appears in SCOPe 2.07
- d1tksa_ appears in the current release, SCOPe 2.08
View in 3D
