Lineage for d1tiid_ (1tii D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1124033Protein Heat-labile toxin [50205] (2 species)
  7. 1124170Species Escherichia coli, type IIB [TaxId:562] [50207] (3 PDB entries)
  8. 1124176Domain d1tiid_: 1tii D: [24965]
    Other proteins in same PDB: d1tii.1

Details for d1tiid_

PDB Entry: 1tii (more details), 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib
PDB Compounds: (D:) heat labile enterotoxin type iib

SCOPe Domain Sequences for d1tiid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiid_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d1tiid_:

Click to download the PDB-style file with coordinates for d1tiid_.
(The format of our PDB-style files is described here.)

Timeline for d1tiid_: