Lineage for d1ticb_ (1tic B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.17: Fungal lipases [53558] (5 proteins) Protein Triacylglycerol lipase [53559] (7 species) 
Species Rhizopus delemar [TaxId:64495] [53565] (1 PDB entry) 
Domain d1ticb_: 1tic B: [34762]
CA-atoms only
Details for d1ticb_
PDB Entry: 1tic (more details)
PDB Description: conformational lability of lipases observed in the absence of an oil- water interface: crystallographic studies of enzymes from the fungi humicola lanuginosa and rhizopus delemar
PDB Compounds: (B:) LipaseSCOPe Domain Sequences for d1ticb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ticb_ c.69.1.17 (B:) Triacylglycerol lipase {Rhizopus delemar [TaxId: 64495]}
sdggkvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsll
sdtngyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvv
ndyfpvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprv
gnptfayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseie
tkdcsnsivpftsildhlsyfdinegscl
SCOPe Domain Coordinates for d1ticb_:
Click to download the PDB-style file with coordinates for d1ticb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ticb_:
- d1ticb_ first appeared (with stable ids) in SCOP 1.55
- d1ticb_ appears in SCOPe 2.07
View in 3D
