Lineage for d1tiaa_ (1tia A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. Protein Triacylglycerol lipase [53559] (7 species)
  7. Species Penicillium camembertii [TaxId:5075] [53562] (1 PDB entry)
  8. Domain d1tiaa_: 1tia A: [34737]
    CA-atoms only

Details for d1tiaa_

PDB Entry: 1tia (more details)

PDB Description: an unusual buried polar cluster in a family of fungal lipases
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1tiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}
dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
sfdgntgtglplltdfeahiwyfvqvdagkg

SCOPe Domain Coordinates for d1tiaa_ are not available.

Timeline for d1tiaa_: