Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) |
Domain d1ti8b1: 1ti8 B:1-166 [119280] Other proteins in same PDB: d1ti8a1 complexed with man, nag, ndg |
PDB Entry: 1ti8 (more details), 3 Å
SCOPe Domain Sequences for d1ti8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti8b1 h.3.1.1 (B:1-166) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidltdsemnklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreea
Timeline for d1ti8b1: