Lineage for d1ti8a1 (1ti8 A:13-325)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (3 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) Protein Hemagglutinin [49824] (5 species)
includes rudiment esterase domainSpecies Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries) 
Domain d1ti8a1: 1ti8 A:13-325 [119279]
Other proteins in same PDB: d1ti8b1
complexed with man, nag, ndg
Details for d1ti8a1
PDB Entry: 1ti8 (more details), 3 Å
PDB Description: h7 haemagglutinin
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d1ti8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti8a1 b.19.1.2 (A:13-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstteq
tklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryvkq
eslmlatgmknvpe
SCOPe Domain Coordinates for d1ti8a1:
Click to download the PDB-style file with coordinates for d1ti8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ti8a1:
- d1ti8a1 first appeared in SCOP 1.73
- d1ti8a1 appears in SCOP 1.75
- d1ti8a1 appears in SCOPe 2.02
- d1ti8a1 appears in the current release, SCOPe 2.08
View in 3D
