Lineage for d1thva_ (1thv A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793908Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 793909Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 793910Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 793918Protein Thaumatin [49876] (1 species)
  7. 793919Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (19 PDB entries)
    Uniprot P02883
  8. 793933Domain d1thva_: 1thv A: [23904]

Details for d1thva_

PDB Entry: 1thv (more details), 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin
PDB Compounds: (A:) thaumatin isoform a

SCOP Domain Sequences for d1thva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thva_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1thva_:

Click to download the PDB-style file with coordinates for d1thva_.
(The format of our PDB-style files is described here.)

Timeline for d1thva_: