Lineage for d1tgzb_ (1tgz B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein SUMO-1 (smt3 homologue) [54241] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
Uniprot Q93068
Domain d1tgzb_: 1tgz B: [106902]
Other proteins in same PDB: d1tgza_
complexed with so4
Details for d1tgzb_
PDB Entry: 1tgz (more details), 2.8 Å
PDB Description: Structure of human Senp2 in complex with SUMO-1
PDB Compounds: (B:) Ubiquitin-like protein SMT3CSCOPe Domain Sequences for d1tgzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgzb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg
SCOPe Domain Coordinates for d1tgzb_:
Click to download the PDB-style file with coordinates for d1tgzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tgzb_:
- d1tgzb_ first appeared in SCOP 1.69
- d1tgzb_ appears in SCOPe 2.07
View in 3D
