Lineage for d1tfva2 (1tfv A:240-307)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
secreted during involution
Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (9 PDB entries)
Uniprot Q7YS85
Domain d1tfva2: 1tfv A:240-307 [106861]
Other proteins in same PDB: d1tfva1
Details for d1tfva2
PDB Entry: 1tfv (more details), 2.9 Å
PDB Description: crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
PDB Compounds: (A:) mammary gland protein 40SCOPe Domain Sequences for d1tfva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd
SCOPe Domain Coordinates for d1tfva2:
Click to download the PDB-style file with coordinates for d1tfva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfva2:
- d1tfva2 first appeared in SCOP 1.69
- d1tfva2 appears in SCOPe 2.07
View in 3D
