Lineage for d1tfua_ (1tfu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359548Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1359653Protein Phosphopantetheine adenylyltransferase [52398] (5 species)
  7. 1359665Species Mycobacterium tuberculosis [TaxId:1773] [110492] (7 PDB entries)
    Uniprot Q50452
  8. 1359671Domain d1tfua_: 1tfu A: [106859]

Details for d1tfua_

PDB Entry: 1tfu (more details), 1.99 Å

PDB Description: phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1tfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

SCOPe Domain Coordinates for d1tfua_:

Click to download the PDB-style file with coordinates for d1tfua_.
(The format of our PDB-style files is described here.)

Timeline for d1tfua_: