Lineage for d1tfra1 (1tfr A:183-305)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090876Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 1090877Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 1090901Protein T4 RNase H [47809] (1 species)
  7. 1090902Species Bacteriophage T4 [TaxId:10665] [47810] (2 PDB entries)
  8. 1090903Domain d1tfra1: 1tfr A:183-305 [18081]
    Other proteins in same PDB: d1tfra2
    complexed with mg

Details for d1tfra1

PDB Entry: 1tfr (more details), 2.06 Å

PDB Description: rnase h from bacteriophage t4
PDB Compounds: (A:) t4 RNAse h

SCOPe Domain Sequences for d1tfra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfra1 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

SCOPe Domain Coordinates for d1tfra1:

Click to download the PDB-style file with coordinates for d1tfra1.
(The format of our PDB-style files is described here.)

Timeline for d1tfra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfra2