Lineage for d1tfmb2 (1tfm B:134-255)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
duplication: consists of two domains of this foldSpecies European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
different sequence variants
Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
Domain d1tfmb2: 1tfm B:134-255 [106857]
Other proteins in same PDB: d1tfma_
complexed with gal, nag, p6c
Details for d1tfmb2
PDB Entry: 1tfm (more details), 2.8 Å
PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form
PDB Compounds: (B:) Himalayan mistletoe ribosome-inactivating proteinSCOPe Domain Sequences for d1tfmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfmb2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpeqnqdqcltsgrds
vaginivscsggssgqrwvftnegailnlknglamdvanpglgqiiiypatgkpnqmwlp
vp
SCOPe Domain Coordinates for d1tfmb2:
Click to download the PDB-style file with coordinates for d1tfmb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfmb2:
- d1tfmb2 first appeared in SCOP 1.69
- d1tfmb2 appears in SCOPe 2.06
- d1tfmb2 appears in the current release, SCOPe 2.08
View in 3D
