Class g: Small proteins [56992] (98 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Domain d1tf6a4: 1tf6 A:101-131 [45063] protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 1tf6 (more details), 3.1 Å
SCOPe Domain Sequences for d1tf6a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf6a4 g.37.1.1 (A:101-131) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]} kicvyvchfencgkafkkhnqlkvhqfshtq
Timeline for d1tf6a4: