Lineage for d1tf6a4 (1tf6 A:101-131)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
    duplication: consists of 6 fingers
  7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (4 PDB entries)
  8. 3035237Domain d1tf6a4: 1tf6 A:101-131 [45063]
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d1tf6a4

PDB Entry: 1tf6 (more details), 3.1 Å

PDB Description: co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region
PDB Compounds: (A:) protein (transcription factor iiia)

SCOPe Domain Sequences for d1tf6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf6a4 g.37.1.1 (A:101-131) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kicvyvchfencgkafkkhnqlkvhqfshtq

SCOPe Domain Coordinates for d1tf6a4:

Click to download the PDB-style file with coordinates for d1tf6a4.
(The format of our PDB-style files is described here.)

Timeline for d1tf6a4: