Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
Protein Enolase [54828] (8 species) |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries) Uniprot P09104 |
Domain d1te6a2: 1te6 A:1-139 [106798] Other proteins in same PDB: d1te6a1, d1te6b1 complexed with cl, mg, po4, trs |
PDB Entry: 1te6 (more details), 1.8 Å
SCOPe Domain Sequences for d1te6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te6a2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka gaaerelplyrhiaqlagn
Timeline for d1te6a2: